PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA05G0055700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 287aa    MW: 30463.5 Da    PI: 9.7714
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA05G0055700.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.81.4e-14124168347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +WT+eE+  ++ +  +lG+g+W+ I+r++ ++Rt+ q+ s+ qky
  ORGLA05G0055700.1 124 PWTEEEHRMFLAGLDKLGKGDWRGISRHFVTTRTPTQVASHAQKY 168
                        8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.68318IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.988117173IPR017930Myb domain
SuperFamilySSF466891.0E-18118174IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-18120172IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.1E-11121167IPR009057Homeodomain-like
SMARTSM007171.9E-11121171IPR001005SANT/Myb domain
PfamPF002499.3E-12124168IPR001005SANT/Myb domain
CDDcd001676.85E-10124169No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MARKCSSCGN NGHNSRTCSG QRVLDHSISS SNSGSTTAAA ATACGGLRLF GVQLQVGGGS  60
SPLKKCLSME CLASPAYYGA SASPSVSSSS SSLVSIEENT ERVSNGYLSD GLMGRVQERK  120
KGVPWTEEEH RMFLAGLDKL GKGDWRGISR HFVTTRTPTQ VASHAQKYFL RQNSMTQKKR  180
RSSLFDVVEG SKRAAAMPIS GSASELQIPG MSIGVGVVKE EVVLPPCLNL MSNSSSASQH  240
SPSLTLLANP QVQLQMPDLE LKMSTSRLSD QSGPSPSTPF FGTIRVT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0614270.0AK061427.1 Oryza sativa Japonica Group cDNA clone:006-306-H01, full insert sequence.
GenBankAK0655940.0AK065594.1 Oryza sativa Japonica Group cDNA clone:J013029P13, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637665.10.0PREDICTED: transcription factor MYB1R1
TrEMBLA0A0D3G4700.0A0A0D3G470_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0HAQ80.0A0A0E0HAQ8_ORYNI; Uncharacterized protein
TrEMBLI1PT590.0I1PT59_ORYGL; Uncharacterized protein
TrEMBLA0A0D9ZVC70.0A0A0D9ZVC7_9ORYZ; Uncharacterized protein
STRINGORGLA05G0055700.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42313873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.13e-46MYB_related family protein